Bacterial taxon 1392858
Locus CO715_22795
Protein ATI08304.1
DUF1435 domain-containing protein
Escherichia coli M12
Length 91 aa, Gene n/a, UniProt n/a
>ATI08304.1|Escherichia coli M12|DUF1435 domain-containing protein
MILVIIINERDETMLQRTLGSGWGVLLPGLLIAGLMYADLSPDQWRIVILMGLVLTSVMLYHKQLRHYVLLPSCLALIAAIMLMIMNLNQG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.54 | 0.00023 | ●●○○○ -1.44 | -1.4443658454161499 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -6.22 | 0.0072 | ●○○○○ -0.75 | -0.7510351400671841 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)