Bacterial taxon 1392858
Locus CO715_18075
Protein ATI07456.1
DUF1471 domain-containing protein
Escherichia coli M12
Length 86 aa, Gene n/a, UniProt n/a
>ATI07456.1|Escherichia coli M12|DUF1471 domain-containing protein
MSIKQNLFAALFLCTLTGHAFAATEIHKPDNNLEQLSKVSMSTHNSNPAGVESQIKEKAEELQASNYYISSFSGKNYIHATVIFYK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 0.73 | 0.0064 | ○○○○○ 0.7 | 0.6978027828769083 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.04 | 9.4e-14 | ○○○○○ 0.97 | 0.970711769514419 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)