Bacterial taxon 1392858
Locus CO715_20295
Protein ATI07857.1
DUF1615 domain-containing protein
Escherichia coli M12
Length 364 aa, Gene n/a, UniProt n/a
>ATI07857.1|Escherichia coli M12|DUF1615 domain-containing protein
MSRVNHLSSLSLLAVLVLAGCSSQAPQPLKKGEKAIDVASVVRQKMPASVKDRDAWAKDLATTFESQGLAPTLENVCSVLAVAQQESNYQADPAVPGLSKIAWQEIDRRAERMHIPAFLVHTALKIKSPNGKSYSERLDSVRTEKQLSAIFDDLISMVPMGQTLFGSLNPVRTGGPMQVSIAFAEQHTKGYPWKMDGTVRQEVFSRRGGLWFGTYHLLNYPASYSAPIYRFADFNAGWYASRNAAFQNAVSKASGVKLALDGDLIRYDSKEPGKTELATRKLAGKLGMSDSEIRRQLEKGDSFSFEETALYKKVYQLAEAKTGKSLPREMLPGIQLESPKITRNLTTAWFAKRVDERRARCMKQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.44 | 0.0012 | ○○○○○ 0.85 | 0.8465673910363464 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.83 | 8.2e-5 | ○○○○○ 0.93 | 0.927104752536407 | 29101196 |
Retrieved 2 of 2 entries in 0.3 ms
(Link to these results)