Bacterial taxon 1392858
Locus CO715_20240
Protein ATI07846.1
DUF188 domain-containing protein
Escherichia coli M12
Length 152 aa, Gene n/a, UniProt n/a
>ATI07846.1|Escherichia coli M12|DUF188 domain-containing protein
MTIWVDADACPNVIKEILYRAAERMQLPLVLVANQSLRVPPSRFIRTLRVAAGFDVADNEIVRQCEAGDLVITADIPLAAEAIEKGAAALNPRGERYTPATIRERLTMRDFMDTLRASGIQTGGPDSLSQRDRQAFAAELEKWWLEVQRSRG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.31 | 1.1e-18 | ●●○○○ -1.19 | -1.1871053098473043 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.24 | 7.1e-24 | ●○○○○ -0.96 | -0.964897304672267 | 29101196 |
Retrieved 2 of 2 entries in 0.3 ms
(Link to these results)