Bacterial taxon 1392858
Locus CO715_11600
Protein ATI06293.1
DUF2627 domain-containing protein
Escherichia coli M12
Length 47 aa, Gene n/a, UniProt n/a
>ATI06293.1|Escherichia coli M12|DUF2627 domain-containing protein
MCGIFSKEVLSKHVDVEYRFSAEPYIGASCSNVSVLSMLCLRAKKTI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.32 | 5.9e-11 | ●●○○○ -1.81 | -1.8149211667221279 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.47 | 3.9e-9 | ●●○○○ -1.22 | -1.2209059641556197 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)