Bacterial taxon 1392858
Locus CO715_05685
Protein ATI05262.1
DUF4222 domain-containing protein
Escherichia coli M12
Length 99 aa, Gene n/a, UniProt n/a
>ATI05262.1|Escherichia coli M12|DUF4222 domain-containing protein
MRTYLSGLTASGYAHPKIIPGAIYLDKNGNRVTVKELMFDRVYFIRDGYSFHSSLNVEIFISRFRREIPLSRNNHVSCMDVDKKLQELKNMIAAWREQK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -12.84 | 3.8e-11 | ●●●○○ -2.13 | -2.132480400408894 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -11.03 | 1.5e-8 | ●●○○○ -1.75 | -1.754413822589958 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)