Bacterial taxon 1392858
Locus CO715_18170
Protein ATI07474.1
ECF transporter S component
Escherichia coli M12
Length 192 aa, Gene n/a, UniProt n/a
>ATI07474.1|Escherichia coli M12|ECF transporter S component
MARRHFSSQALVLIVISIAINMIGGQLASMVKLPIFLDSIGTLISAVLLGPVIGMLTGLLTNLLWGLLTDPIAAAFAPVAMVIGLVAGWLARAGWFRTLPKVVVSGVIITLAVTVVAVPLRTALFGGVTGSGADLFVAWMHSMGQNLVESVAITVIGANLVDKILTAVIVWLLLRQLPIRTTRHFPAMAAVR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.26 | 0.0028 | ○○○○○ 0.28 | 0.2823885685074256 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.03 | 0.022 | ○○○○○ 0.76 | 0.7616484632370599 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)