Bacterial taxon 1392858
Locus CO715_17905
Protein ATI07426.1
effector protein
Escherichia coli M12
Length 162 aa, Gene n/a, UniProt n/a
>ATI07426.1|Escherichia coli M12|effector protein
MKSLIIVNPADCIGCRTCEVACVVAHPSEQELNADVFLPRLKVQRLDSISAPVMCHQCENAPCVSACPVGALTMGEQVVQTNSARCIGCQSCVSACPFGMITIQSLPGDTRQQIVKCDLCEQREEGPACVESCPTQALQLLTERELRRVRQQRIVASGENPL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.92 | 2.7e-7 | ○○○○○ 0.14 | 0.1446821991031772 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.2 | 0.0022 | ○○○○○ 0.29 | 0.2949073293623573 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)