Bacterial taxon 1392858
Locus CO715_03410
Protein ATI04867.1
endonuclease SmrB
Escherichia coli M12
Length 183 aa, Gene n/a, UniProt n/a
>ATI04867.1|Escherichia coli M12|endonuclease SmrB
MKKKTTLSEEDQALFRQLMAGTRKIKQDTIVHRPQRKKISEVPVKRLIQEQADASHYFSDEFQPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLDLHGLTQLQAKQELGALIAACRREHVFCACVMHGHGKHILKQQTPLWLAQHPHVMAFHQAPKEYGGDAALLVLIEVDEWLPPELP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.88 | 3.3e-5 | ●●○○○ -1.1 | -1.0978048157487914 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.15 | 0.00022 | ●○○○○ -0.95 | -0.9461191633898695 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)