Bacterial taxon 1392858
Locus CO715_04320
Protein ATI05039.1
endonuclease V
Escherichia coli M12
Length 223 aa, Gene n/a, UniProt n/a
>ATI05039.1|Escherichia coli M12|endonuclease V
MDLASLRAQQIELASSVIREDRLDKDPPDLIAGADVGFEQGGEVTRAAMVLLKYPSLELVEYKVARIATTMPYIPGFLSFREYPALLAAWEMLSQKPDLVFVDGHGISHPRRLGVASHFGLLVDVPTIGVAKKRLCGKFEPLSSEPGALAPLMDKGEQLAWVWRSKARCNPLFIATGHRVSVDSALAWVQRCMKGYRLPEPTRWADAVASERPAFVRYTANQP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 9.15 | 7.6e-5 | ○○○○○ 2.46 | 2.4556454529235645 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 10.35 | 2.9e-6 | ○○○○○ 2.7 | 2.704768793936705 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)