Bacterial taxon 1392858
Locus CO715_02835
Protein ATI04766.1
ethanolamine utilization acetate kinase EutP
Escherichia coli M12
Length 159 aa, Gene n/a, UniProt n/a
>ATI04766.1|Escherichia coli M12|ethanolamine utilization acetate kinase EutP
MKRIAFVGTVGAGKTTLFNALQGDYTLARKTQAVEFNDKGDIDTPGEYFSHPRWYHALITTLQDVDMLIYVHGANDPESRLPAGLLDIGVSKRQIAVISKTDMPDADVTATRKLLLETGFEEPIFELNSHDPQSVQQLVDYLASLTKQEEAGEKTHHSE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.71 | 8.9e-32 | ●●○○○ -1.06 | -1.0633782233977296 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -0.75 | 0.021 | ○○○○○ 0.39 | 0.3904672038883358 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)