Bacterial taxon 1392858
Locus CO715_02860
Protein ATI04770.1
ethanolamine utilization protein EutN
Escherichia coli M12
Length 95 aa, Gene n/a, UniProt n/a
>ATI04770.1|Escherichia coli M12|ethanolamine utilization protein EutN
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.77 | 8.2e-22 | ●●○○○ -1.28 | -1.2828738303875316 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -6.26 | 4.3e-5 | ●○○○○ -0.76 | -0.7600069186798851 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)