Bacterial taxon 1392858
Locus CO715_03840
Protein ATI04948.1
Fe-S biogenesis protein NfuA
Escherichia coli M12
Length 191 aa, Gene n/a, UniProt n/a
>ATI04948.1|Escherichia coli M12|Fe-S biogenesis protein NfuA
MIRISDAAQAHFAKLLANQEEGTQIRVFVINPGTPNAECGVSYCPPDAVEATDTALKFDLLTAYVDELSAPYLEDAEIDFVTDQLGSQLTLKAPNAKMRKVADDAPLMERVEYMLQSQINPQLAGHGGRVSLMEITEDGYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGVRDLTEHQRGEHSYY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.99 | 1.2e-8 | ●●○○○ -1.75 | -1.747319858105497 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.41 | 2.4e-10 | ●●○○○ -1.63 | -1.6260965238269083 | 29101196 |
Retrieved 2 of 2 entries in 1.3 ms
(Link to these results)