Bacterial taxon 1392858
Locus CO715_17220
Protein ATI07304.1
ferredoxin family protein
Escherichia coli M12
Length 86 aa, Gene n/a, UniProt n/a
>ATI07304.1|Escherichia coli M12|ferredoxin family protein
MSVARNLWRVADAPHIVPADSVERQTVQRLINACPAGLFSLTPEGDLRVDYRGCLECGTCRLLCDESTLQQWRYPPSGFGITYRFG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.02 | 5.0e-12 | ○○○○○ 0.12 | 0.12444353572103767 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.86 | 5.1e-11 | ○○○○○ 0.93 | 0.9335727789781216 | 29101196 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)