Bacterial taxon 1392858
Locus CO715_03395
Protein ATI04864.1
fimbrial protein
Escherichia coli M12
Length 156 aa, Gene n/a, UniProt n/a
>ATI04864.1|Escherichia coli M12|fimbrial protein
MKRISLLVLWGFCSMALSNVSFHGYLVQPPNCTISNAQTIEITFQDVFVDDINGSNYEQTVPYSITCDTAVRDPSMEMTLSWSGTQSDFDDAAVSSNITGLGIQLKQAGQRFRINTPLVVNETDLPVLTAVPVKKSGVDLPEADFEAWATLQVDYQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.36 | 0.00011 | ●●○○○ -1.2 | -1.1981635486024937 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 4.64 | 0.0018 | ○○○○○ 1.51 | 1.5142346366327024 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)