Bacterial taxon 1392858
Locus CO715_09325
Protein ATI05894.1
fimbrial protein
Escherichia coli M12
Length 243 aa, Gene n/a, UniProt n/a
>ATI05894.1|Escherichia coli M12|fimbrial protein
MTFMKGLPLLLLIASLCSYAALQPDRTRIVFNANDKATSLRVDNRSDKLPYLAYSWLENEKGEKSDDLLVALPPIQRLEPKATTQVRIVKQASTAKLPGDRETLFFYNMREIPPSPEKNSGHAVLQVAIQSRIKVFWRPSALRKKAGEKVELQLQVSQQGNQLNLKNPTGYYLTIAYLGRNEQGVLPGFKTVMVAPFSTVITNTGSYSGSQFYLGYMDDYGALRMTTLNCNGHCRLQAVEAKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -0.46 | 0.033 | ○○○○○ 0.45 | 0.4497226719350123 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.38 | 1.1e-63 | ○○○○○ 1.25 | 1.2519665967218838 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)