Bacterial taxon 1392858
Locus CO715_05130
Protein ATI05167.1
flagella export chaperone FliS
Escherichia coli M12
Length 136 aa, Gene n/a, UniProt n/a
>ATI05167.1|Escherichia coli M12|flagella export chaperone FliS
MYAAKGTQAYAQIGVESAVMSASQQQLVTMLFDGVLSALVRARLFMQDNNQQGKGVSLSKAINIIENGLRVSLDEESKDELTQNLIALYSYMVRRLLQANLRNDVSAVEEVEALMRNIADAWKESLLSPSLIQDPV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.17 | 2.9e-5 | ●●○○○ -1.78 | -1.7848761406702918 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.18 | 0.00083 | ●●○○○ -1.37 | -1.3684186962295646 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)