Bacterial taxon 1392858
Locus CO715_20895
Protein ATI07966.1
flagellar assembly peptidoglycan hydrolase FlgJ
Escherichia coli M12
Length 313 aa, Gene n/a, UniProt n/a
>ATI07966.1|Escherichia coli M12|flagellar assembly peptidoglycan hydrolase FlgJ
MISDSKLLASAAWDAQSLNELKAKAGEDPAANIRPVARQVEGMFVQMMLKSMRDALPKDGLFSSEHTRLYTSMYDQQIAQQMTAGKGLGLAEMMVKQMTPEQPLPEESTPAAPMKFPLETVVRYQNQTLSQLVQKAVPRNYDDSLPGDSKAFLAQLSLPAQLASQQSGVPHHLILAQAALESGWGQRQIRRENGEPSYNLFGVKASDNWKGPVTEITTTEYENGEAKKVKAKFRVYSSYLEALSDYVGLLTRNPRYAAVTTAASAEQGAQALQDAGYATDPHYARKLTNMIQQMKSISDKVSKTYSMNIDNLF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.37 | 0.00016 | ●●○○○ -1.2 | -1.199624070702236 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.67 | 0.0034 | ●○○○○ -0.64 | -0.6362798322303105 | 29101196 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)