Bacterial taxon 1392858
Locus CO715_04695
Protein ATI05095.1
flagellar biosynthetic protein FliQ
Escherichia coli M12
Length 89 aa, Gene n/a, UniProt n/a
>ATI05095.1|Escherichia coli M12|flagellar biosynthetic protein FliQ
MTPESVMMMGTEAMKVALALAAPLLLVALVTGLIISILQAATQINEMTLSFIPKIIAVFIAIIIAGPWMLNLLLDYVRTLFTNLPYIIG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.86 | 2.0e-8 | ●●○○○ -1.51 | -1.5111325699757856 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.37 | 2.1e-6 | ●○○○○ -0.78 | -0.7831666262615089 | 29101196 |
Retrieved 2 of 2 entries in 1.3 ms
(Link to these results)