Bacterial taxon 1392858
Locus CO715_17960
Protein ATI07437.1
flavodoxin-2
Escherichia coli M12
Length 173 aa, Gene n/a, UniProt n/a
>ATI07437.1|Escherichia coli M12|flavodoxin-2
MNMGLFYGSSTCYTEMAAEKIRDIIGPELVTLHNLKDDSPKLMEQYDVLILGIPTWDFGEIQEDWEAVWDQLDDLNLEGKIVALYGLGDQLGYGEWFLDALGMLHDKLSTKGVKFVGYWPTEGYEFTSPKPVIADGQLFVGLALDETNQYDLSDERIQSWCEQILNEMAEHYA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.46 | 0.0089 | ●●○○○ -1.64 | -1.6367374705536002 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.04 | 0.019 | ●●○○○ -1.55 | -1.5491061445690784 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)