Bacterial taxon 1392858
Locus CO715_08660
Protein ATI05779.1
fructose-6-phosphate aldolase
Escherichia coli M12
Length 220 aa, Gene n/a, UniProt n/a
>ATI05779.1|Escherichia coli M12|fructose-6-phosphate aldolase
MELYLDTSDVVAVKALSRIFPLAGVTTNPSIIAAGKKPLEVVLPELHEAMGGQGRLFAQVMATTAEGMVNDARKLRSIIADIVVKVPVTAEGLAAIKMLKAEGIPTLGTAVYGAAQGLLSALAGAEYVAPYVNRIDAQGGSGIQTVTDLHQLLKMHAPQAKVLAASFKTPRQALDCLLAGCESITLPLDVAQQMISYPAVDAAVAKFEQDWQGAFGRTSI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -12.53 | 5.2e-12 | ●●●○○ -2.07 | -2.0675914899774988 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.8 | 5.3e-10 | ●●○○○ -1.5 | -1.498822455135103 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)