Bacterial taxon 1392858
Locus CO715_03135
Protein ATI04817.1
fructose-like phosphotransferase enzyme IIB component 1
Escherichia coli M12
Length 108 aa, Gene n/a, UniProt n/a
>ATI04817.1|Escherichia coli M12|fructose-like phosphotransferase enzyme IIB component 1
MSKKLIALCACPMGLAHTFMAAQALEEAAVEAGYEVKIETQGADGIQNRLTAQDIAEATIIIHSVAVTPEDNERFESRDVYEITLQDAIKNAAGIIKEIEEMIASEQQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.03 | 3.9e-5 | ●●○○○ -1.34 | -1.337747732134982 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.98 | 0.00013 | ●●○○○ -1.12 | -1.1195040012306732 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)