Bacterial taxon 1392858
Locus CO715_12065
Protein ATI06378.1
glc operon transcriptional activator
Escherichia coli M12
Length 254 aa, Gene n/a, UniProt n/a
>ATI06378.1|Escherichia coli M12|glc operon transcriptional activator
MKDERRPICEVVAESIERLIIDGVLKVGQPLPSERRLCEKLGFSRSALREGLTVLRGRGIIETAQGRDSRVARLNRVQDTSPLIHLFSTQPRTLYDLLDVRALLEGESARLAATLGTQADFVVITRCYEKMLAASENNKEISLIEHAQLDHAFHLAICQASHNQVLVFTLQSLTDLMFNSVFASVNNLYHRPQQKKQIDRQHARIYNAVLQRLPHVAQRAARDHVRTVKKNLHDIELEGHHLIRSAVPLEMNLS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.86 | 4.4e-7 | ●●○○○ -1.09 | -1.0944664795208099 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.9 | 1.7e-5 | ●○○○○ -0.68 | -0.6848943535502953 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)