Bacterial taxon 1392858
Locus CO715_13610
Protein ATI06650.1
gluconate 5-dehydrogenase
Escherichia coli M12
Length 254 aa, Gene n/a, UniProt n/a
>ATI06650.1|Escherichia coli M12|gluconate 5-dehydrogenase
MNDLFSLAGKNILITGSAQGIGFLLATGLGKYGAQIIINDITAERAELAVEKLHQEGIQAVAAPFNVTHKHEIDAAVEHIEKDIGPIDVLVNNAGIQRRHPFTEFPEQEWNDVIAVNQTAVFLVSQAVTRHMVERKAGKVINICSMQSELGRDTITPYAASKGAVKMLTRGMCVELARHNIQVNGIAPGYFKTEMTKALVEDEAFTAWLCKRTPAARWGDPQELIGAAVFLSSKASDFVNGHLLFVDGGMLVAV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.1 | 4.6e-13 | ○○○○○ 0.78 | 0.7758363922059824 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.44 | 1.5e-20 | ○○○○○ 0.85 | 0.847193329079093 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)