Bacterial taxon 1392858
Locus CO715_09205
Protein ATI05873.1
glutamate mutase sigma subunit
Escherichia coli M12
Length 149 aa, Gene n/a, UniProt n/a
>ATI05873.1|Escherichia coli M12|glutamate mutase sigma subunit
MKKATLVIGVIGADCHAVGNKVLDRVFSNHDFRVINLGVMVSQDEYIDAAIETGADAIVVSSIYGHGDIDCLGMRERCIERGLGNILLYVGGNLVVGKHDFADVETKFKEMGFDRVFSPSHDLEDVCQLMAHDINQRHNVDTRILEEAI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.38 | 1.1e-6 | ○○○○○ 0.26 | 0.2588115688973043 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.31 | 1.3e-6 | ○○○○○ 0.82 | 0.8186088251269991 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)