Bacterial taxon 1392858
Locus CO715_10990
Protein ATI06178.1
glutathione peroxidase
Escherichia coli M12
Length 183 aa, Gene n/a, UniProt n/a
>ATI06178.1|Escherichia coli M12|glutathione peroxidase
MQDSILTTVVKDIDGEVTTLEKYAGNVLLIVNVASKCGLTPQYEQLENIQKAWADRGFVVLGFPCNQFLEQEPGSDEEIKTYCTTTWGVTFPMFSKIEVNGEGRHPLYQKLIAAAPTAVAPEESGFYARMVSKGRAPLYPDDILWNFEKFLVGRDGLVIQRFSPDMTPEDPIVMESIKLALAK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.03 | 7.7e-22 | ●●○○○ -1.34 | -1.3385823161919774 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.04 | 3.1e-8 | ○○○○○ 1.18 | 1.1810269518772711 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)