Bacterial taxon 1392858
Locus CO715_12630
Protein ATI06476.1
glycerate 2-kinase
Escherichia coli M12
Length 381 aa, Gene n/a, UniProt n/a
>ATI06476.1|Escherichia coli M12|glycerate 2-kinase
MKIVIAPDSYKESLSASEVAQAIEKGFREIFPDAQYVSVPVADGGEGTVEAMIAATQGSERHAWVTGPLGEKVNASWGISGDGKTAFIEMAAASGLELVPAEKRDPLVTTSRGTGELILQALESGATNIIIGIGGSATNDGGAGMVQALGAKLCDANGNEIGFGGGSLNTLNDIDISGLDPRLKDCVIRVACDVTNPLVGDNGASRIFGPQKGASEAMIVELDNNLSHYADVIKKALHVDVKDVPGAGAAGGMGAALMAFLGAELKSGIEIVTTALNLEEHIHDCTLVITGEGRIDSQSIHGKVPIGVANVAKKYHKPVIGIAGSLTNDVGVVHQHGIDAVFSVLTSIGTLDEAFRGAYDNIYRASRNIAATLAIGMRNVG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 0.96 | 0.015 | ○○○○○ 0.75 | 0.7468345962253907 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.49 | 1.1e-9 | ○○○○○ 1.07 | 1.0656457059976507 | 29101196 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)