Bacterial taxon 1392858
Locus CO715_11640
Protein ATI06299.1
glycerol-3-phosphate acyltransferase
Escherichia coli M12
Length 205 aa, Gene n/a, UniProt n/a
>ATI06299.1|Escherichia coli M12|glycerol-3-phosphate acyltransferase
MSAIAPGMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGATNVLRIGGKGAAVAVLIFDVLKGMLPVWGAYELGVSPFWLGLIAIAACLGHIWPVFFGFKGGKGVATAFGAIAPIGWDLTGVMAGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVSMLSCLILLRHHDNIQRLWRRQETKIWTKFKRKREKDPE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.82 | 2.8e-12 | ●●○○○ -1.29 | -1.2941407151569702 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.17 | 2.5e-12 | ●○○○○ -0.95 | -0.9492488536036023 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)