Bacterial taxon 1392858
Locus CO715_18000
Protein ATI07444.1
glycine cleavage system protein H
Escherichia coli M12
Length 129 aa, Gene n/a, UniProt n/a
>ATI07444.1|Escherichia coli M12|glycine cleavage system protein H
MSNVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVKAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDATAYEALLEDE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.93 | 2.4e-8 | ●●○○○ -1.94 | -1.9434471114994263 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.13 | 3.1e-6 | ●●○○○ -1.57 | -1.5670497017944807 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)