Bacterial taxon 1392858
Locus CO715_24505
Protein ATI08592.1
GNAT family N-acetyltransferase
Escherichia coli M12
Length 150 aa, Gene n/a, UniProt n/a
>ATI08592.1|Escherichia coli M12|GNAT family N-acetyltransferase
MNNIHIRNYQPGDFQQLCAIFLRAVTMTASQHYSPQQIAAWAQIDESRWKDKLAKSQVRVAVINAQPVGFISRIEHYIDMLFVDPEYTRRGVASALLKPLIKSESELTVDASITAKPFFERYGFQTVKQQCVECRGAWFTNFYMRYKPQH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.16 | 4.8e-6 | ○○○○○ 0.79 | 0.7887724450894119 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.26 | 1.8e-40 | ○○○○○ 1.23 | 1.226094490955025 | 29101196 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)