Bacterial taxon 1392858
Locus CO715_22850
Protein ATI08314.1
GntR family transcriptional regulator
Escherichia coli M12
Length 301 aa, Gene n/a, UniProt n/a
>ATI08314.1|Escherichia coli M12|GntR family transcriptional regulator
MSRSQNLRHSVINQVIEDMARGNIPSPLPSQSGLAEMYNISRTTVRHILQHLSACGVLTLVGKNYVIARKPEQNDGFDCITASLKEQNRLFEQAFFTMINLRQLRAGESFSELQLARAASVSPVVVREYLLKFGRYNLIQSEKRGQWSMKQFDQSYAEQLFELREMLETHSLQHFLNLPDDDPRWLQAKTMLERHRTLRDSIGSNFRMFSQLDRDFHAMLLSAADNIFFNQSLEIISVIFHFHYQWDESDLKQRNIIAVDEHMTILSALICRSDLDAITALRNHLDTAKQSMIRSIRQHHR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.64 | 1.5e-37 | ○○○○○ 0.2 | 0.2039376671498538 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 0.3 | 0.029 | ○○○○○ 0.61 | 0.6085022887783957 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)