Bacterial taxon 1392858
Locus CO715_05645
Protein ATI05255.1
head decoration protein
Escherichia coli M12
Length 110 aa, Gene n/a, UniProt n/a
>ATI05255.1|Escherichia coli M12|head decoration protein
MTSKETFTHYQPQGNSDPAHTATAPGGLSAKAPAMTPLMLDTSSRKLVAWDGTTDGAAVGILAVAADQTSTTLTFYKSGTFRYEDVLWPEAASDETKKRTAFAGTAISIV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.75 | 0.0077 | ●●○○○ -1.49 | -1.4877642163799132 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.33 | 0.017 | ●●○○○ -1.4 | -1.4001328903953913 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)