Bacterial taxon 1392858
Locus CO715_14340
Protein ATI06781.1
helix-turn-helix transcriptional regulator
Escherichia coli M12
Length 176 aa, Gene n/a, UniProt n/a
>ATI06781.1|Escherichia coli M12|helix-turn-helix transcriptional regulator
MFLIITRDTMFFTAMKNILSKGNVVHIQNEEEIDVMLHQHAFVIIDTLMNNVFHSNLLTQIERLKPVHVIIFSPFNIKRCLGKVPVTFVPRTITIIDFVALINGSYCSVPEADVSLSRKQHQVLSCIANQMTTEDILEKLKISLKTFYCHKHNIMMILNLKRINELVRHQHIDYLV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.11 | 4.8e-24 | ●●○○○ -1.35 | -1.354439413274891 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 4.57 | 6.2e-39 | ○○○○○ 1.5 | 1.4990034775925356 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)