Bacterial taxon 1392858
Locus CO715_15140
Protein ATI06931.1
helix-turn-helix transcriptional regulator
Escherichia coli M12
Length 196 aa, Gene n/a, UniProt n/a
>ATI06931.1|Escherichia coli M12|helix-turn-helix transcriptional regulator
MTWQNDYSRDYEVKNHMECQNRSDKYIWSPHDAYFYKGLSELIVDIDRLIYLSLEKIRKDFVFINLNTDSLTEFINRDNEWLSAVKGKQVVLIAARKSEALANYWYYNSNIRGVVYAGLSRDIRKELAYVINGRFLRKDIKKDKITDREMEIIRMTAQGMLPKSIARIENCSVKTVYTHRRNAEAKLYSKIYKLVP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -0.61 | 1.4e-8 | ○○○○○ 0.42 | 0.41946899986892744 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.27 | 5.9e-35 | ○○○○○ 0.81 | 0.8106802765855423 | 29101196 |
Retrieved 2 of 2 entries in 0.3 ms
(Link to these results)