Bacterial taxon 1392858
Locus CO715_14310
Protein ATI06776.1
heme utilization cystosolic carrier protein HutX
Escherichia coli M12
Length 164 aa, Gene n/a, UniProt n/a
>ATI06776.1|Escherichia coli M12|heme utilization cystosolic carrier protein HutX
MSHVSLQEFLKTEPDGTLEVVAEQYNTTLLEVVRNLPSSTIVSGDKFDTVWDTVCEWGNVTTLVHTADVILEFSGELPSGFHRHGYFNLRGKHGMSGHIKAENCTHIALIERKFMGMDTASILFFNKEGSAMLKIFLGRDDHRQLLSEQVNAFHALAASLKEHA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 5,54 | 9,4e-6 | ○○○○○ 1,7 | 1.7011814653996822 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 8,85 | 1,8e-13 | ○○○○○ 2,39 | 2.3926343566204085 | 29101196 |
Retrieved 2 of 2 entries in 0,7 ms
(Link to these results)