Bacterial taxon 1392858
Locus CO715_17980
Protein ATI07441.1
hemolysin III family protein
Escherichia coli M12
Length 219 aa, Gene n/a, UniProt n/a
>ATI07441.1|Escherichia coli M12|hemolysin III family protein
MVQKPLIKQGYSLAEEIANSVSHGIGLVFGIVGLVLLLVQAVDLNASATAITSYSLYGGSMILLFLASTLYHAIPHQRAKMWLKKFDHCAIYLLIAGTYTPFLLVGLDSPLARGLMIVIWSLALLGILFKLTIAHRFKILSLVTYLAMGWLSLVVIYEMAVKLAAGSVTLLAVGGVVYSLGVIFYVCKRIPYNHAIWHGFVLGGSVCHFLAIYLYIGQA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -12.3 | 4.6e-6 | ●●●○○ -2.02 | -2.020437490757256 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.5 | 1.9e-6 | ●●○○○ -1.64 | -1.6440400810523104 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)