Bacterial taxon 1392858
Locus CO715_21650
Protein ATI08102.1
HTH-type transcriptional regulator MlrA
Escherichia coli M12
Length 243 aa, Gene n/a, UniProt n/a
>ATI08102.1|Escherichia coli M12|HTH-type transcriptional regulator MlrA
MALYTIGEVALLCDINPVTLRAWQRRYGLLKPQRTDGGHRLFNDADIDRIREIKRWIDNGVQVSKVKMLLSNENVDVQNGWRDQQETLLTYLQSGNLHSLRTWIKERGQDYPAQTLTTHLFIPLRRRLQCQQPTLQALLAILDGVLINYIAICLASARKKQGKDALVVGWNIHDTTRLWLEGWIASQQGWRIDVLAHSLNQLRPELFEGRTLLVWCGENRTSAQQQQLTSWQEQGHDIFPLGI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.69 | 6.3e-20 | ●●○○○ -1.89 | -1.8925374840227043 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.61 | 5.8e-23 | ●●○○○ -1.46 | -1.4579278363423263 | 29101196 |
Retrieved 2 of 2 entries in 1.3 ms
(Link to these results)