Bacterial taxon 1392858
Locus CO715_11970
Protein ATI06361.1
hydrogenase-2 operon protein HybE
Escherichia coli M12
Length 162 aa, Gene n/a, UniProt n/a
>ATI06361.1|Escherichia coli M12|hydrogenase-2 operon protein HybE
MTEEIAGFQTSPKAQVQAAFEEIARRSMHDLSFLHPSMPVYVSDFTLFEGQWTGCVITPWMLSAVIFPGPDQLWPLRKVSEKIGLQLPYGTMTFTVGELDGVSQYLSCSLMSPLSHSMSIEEGQRLTDDCARMILSLPVTNPDVPHAGRRALLFGRRSGENA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.08 | 3.5e-8 | ●●○○○ -1.35 | -1.3473454487904295 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -4.86 | 0.0013 | ●○○○○ -0.47 | -0.46873708278847487 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)