Bacterial taxon 1392858
Locus CO715_00550
Protein ATI04356.1
hypothetical protein
Escherichia coli M12
Length 102 aa, Gene n/a, UniProt n/a
>ATI04356.1|Escherichia coli M12|hypothetical protein
MMMNSFFPAMALMVLMALVGCSTPPPVQKAQRVKVDPLRSLNMEGLCKDQAAKRYNTGAQKIDVTAFEQFQGSYEMRGYTFRKEQFVCSFDADGHFLHLSMR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.01 | 0.00052 | ○○○○○ 0.76 | 0.7572668969378339 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.06 | 0.00052 | ○○○○○ 0.77 | 0.7674905516360281 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)