Bacterial taxon 1392858
Locus CO715_00665
Protein ATI04375.1
hypothetical protein
Escherichia coli M12
Length 150 aa, Gene n/a, UniProt n/a
>ATI04375.1|Escherichia coli M12|hypothetical protein
MIWIMLATLAVVFVVGFRVLTSGARKAIRRLSDRLNIDVVPVESMVDQMGKSAGDEFLRYLHRPDESHLQNAAQVLLIWQIVIVDGSEQNLLQWHRILQKARLAAPITDAQVRLALGFLRETEPEMQDINAFQMRYNAFFQPAEGVHWLH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 0.87 | 0.0046 | ○○○○○ 0.73 | 0.728473746971491 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.08 | 0.0009 | ○○○○○ 0.77 | 0.7708288878640098 | 29101196 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)