Bacterial taxon 1392858
Locus CO715_00770
Protein ATI04395.1
hypothetical protein
Escherichia coli M12
Length 115 aa, Gene n/a, UniProt n/a
>ATI04395.1|Escherichia coli M12|hypothetical protein
MKISRLGEAPDYRFSLANERTFLAWIRTALGFLAAGVGLDQLAPDFATPVIRELLALLLCLFSGGLAMYGYLRWLRNEKAMRLKEDLPYTNSLLIISLILMVVAVIVMGLVLYAG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.49 | 3.0e-25 | ●●○○○ -1.43 | -1.4345594827464538 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.52 | 0.0025 | ●●○○○ -1.02 | -1.023735480690446 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)