Bacterial taxon 1392858
Locus CO715_01610
Protein ATI04542.1
hypothetical protein
Escherichia coli M12
Length 76 aa, Gene n/a, UniProt n/a
>ATI04542.1|Escherichia coli M12|hypothetical protein
MDRALLDGGYRCYTGEKIDVYFNTAICQHSGNCVRGNGKLFNLKRKPWIMPDEVDVATVVKVIDTCPSGALKYRHK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.23 | 5.2e-18 | ○○○○○ 1.01 | 1.0107718042502003 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.36 | 3.0e-83 | ○○○○○ 1.04 | 1.0381044321168011 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)