Bacterial taxon 1392858
Locus CO715_01640
Protein ATI04547.1
hypothetical protein
Escherichia coli M12
Length 209 aa, Gene n/a, UniProt n/a
>ATI04547.1|Escherichia coli M12|hypothetical protein
MTRTLKPLILNTSALTLTLILIYTGISAHDKLTWLMEVTPVIIVVPLLLATARRYPLTPLLYTLIFFHAIILMVGGQYTYAKVPVGFEVQEWLGLSRNPYDKLGHFFQGLVPALVAREILVRGMYVRGHKMVAFLVCCVALAISAMYELIEWWAALAMGQGADDFLGTQGDQWDTQSDMFCALLGALTTVIFLARFHCRQLRRFGLITG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.3 | 1.7e-23 | ●●○○○ -1.39 | -1.3942908019964235 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -3.35 | 4.9e-8 | ●○○○○ -0.15 | -0.15305566322994782 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)