Bacterial taxon 1392858
Locus CO715_02765
Protein ATI04754.1
hypothetical protein
Escherichia coli M12
Length 66 aa, Gene n/a, UniProt n/a
>ATI04754.1|Escherichia coli M12|hypothetical protein
MDWLAKYWWILVIVFLVGVLLNVIKDLKRVDHKKFLANKPELPPHRDFNDKWDDDDDWPKKDQPKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.65 | 3.8e-14 | ●●○○○ -1.88 | -1.8841916434527497 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.61 | 3.3e-8 | ●○○○○ -0.83 | -0.8326157316384889 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)