Bacterial taxon 1392858
Locus CO715_03120
Protein ATI04814.1
hypothetical protein
Escherichia coli M12
Length 108 aa, Gene n/a, UniProt n/a
>ATI04814.1|Escherichia coli M12|hypothetical protein
MFRSLFLAATLMAFTPLAANAGEITLLPSIKLQIGDRDHYGNYWDGGHWRDRDYWHRNYEWRKNRWWRHDNGYHRGWDKRKAYERGYREGWRDRDDHRGKGRGHGHRH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.98 | 2.8e-8 | ●●○○○ -1.54 | -1.5355441536429026 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.21 | 6.3e-6 | ●○○○○ -0.96 | -0.9575946941735568 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)