Bacterial taxon 1392858
Locus CO715_03295
Protein ATI04846.1
hypothetical protein
Escherichia coli M12
Length 64 aa, Gene n/a, UniProt n/a
>ATI04846.1|Escherichia coli M12|hypothetical protein
MINYLTAKDAAEYLGVCLSRFYQLKRYIPSFPPYINQTINGRKRRVWLASSLDQFADRFLGGRK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.3 | 0.0004 | ●●○○○ -1.39 | -1.3944994480106723 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.11 | 0.0011 | ●●○○○ -1.36 | -1.3552739973318864 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)