Bacterial taxon 1392858
Locus CO715_04040
Protein ATI04984.1
hypothetical protein
Escherichia coli M12
Length 117 aa, Gene n/a, UniProt n/a
>ATI04984.1|Escherichia coli M12|hypothetical protein
MKKIGVAGLQREQIKKTIEATAPGCFEVFIHNDMEAAMKVKSGQLDYYIGACNTGAGAALSIAIAVIGYNKSCTIAKPGIKAKDEHIAKMIAEGKVAFGLSVEHVEHAIPMLINHLK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.6 | 4.4e-13 | ●●○○○ -1.87 | -1.8741766347688043 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.27 | 6.1e-15 | ●●○○○ -1.6 | -1.5962601437893214 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)