Bacterial taxon 1392858
Locus CO715_04800
Protein ATI05111.1
hypothetical protein
Escherichia coli M12
Length 137 aa, Gene n/a, UniProt n/a
>ATI05111.1|Escherichia coli M12|hypothetical protein
MKKLAIAGALMLLAGCAEVENYNNVVKTPAPDWLAGYWQTKGPQRALVSPEAIGSLIVTKEGDTLDCRQWQRVIAVPGKLTLMSDDLTNVTVKRELYEVERDGNTIEYDGMTMERVDRPTAECAAALDKAPLPTPLP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.22 | 1.1e-22 | ●●○○○ -1.38 | -1.3778077668707633 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.04 | 0.0016 | ○○○○○ 0.12 | 0.12110519949305588 | 29101196 |
Retrieved 2 of 2 entries in 0.3 ms
(Link to these results)