Bacterial taxon 1392858
Locus CO715_05420
Protein ATI05217.1
hypothetical protein
Escherichia coli M12
Length 272 aa, Gene n/a, UniProt n/a
>ATI05217.1|Escherichia coli M12|hypothetical protein
MIYIGLPQWSHPKWVRLGITSLEEYARHFNCVEGNTTLYALPKPEVVLRWREQTTDDFRFCFKFPATISHQAALRHCDDLVTEFLTRMSPLAPRIGQYWLQLPATFGPRDLPALWHFLDSLPGEFNYGVEVRHPQFFAKGEEEQTLNRGLHQRGVNRVILDSRPVHAARPHSEAIRDAQRKKPKVPVHAVLTATNPLIRFIGSDDMTQNRELFQVWLQKLAQWHQTTTPYLFLHTPDIAQAPELVHTLWEDLRKTLPEIGAVPAIPQQSSLF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.25 | 4.5e-14 | ●●○○○ -1.8 | -1.801150529781703 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.29 | 2.2e-21 | ●●○○○ -1.39 | -1.3913697577969393 | 29101196 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)