Bacterial taxon 1392858
Locus CO715_05450
Protein ATI05223.1
hypothetical protein
Escherichia coli M12
Length 200 aa, Gene n/a, UniProt n/a
>ATI05223.1|Escherichia coli M12|hypothetical protein
MNINYPAEYEIGDIVFTCIGAALFGQISAASNCWSNHVGIIIGHNGEDFMVAESRVPLSTITTLSRFIKRSSNQRYAIKRLDAGLTEQQKQRIVEQVPSRLRKLYHTGFKYESSRQFCSKFVFDIYKKALCIPVGEIETFGELLNSNPNAKLTFWKFWFLGSIPWERKTVTPASLWHHPGLVLIHAEGVETPQPELTEAV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.64 | 1.5e-61 | ●●○○○ -1.26 | -1.2574190166491706 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.02 | 0.00086 | ○○○○○ 0.33 | 0.3337154880126455 | 29101196 |
Retrieved 2 of 2 entries in 1.5 ms
(Link to these results)